PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015897789.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 175aa    MW: 19210.3 Da    PI: 7.4644
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015897789.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.82.1e-4411109199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+
  XP_015897789.1  11 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKELD 105
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_015897789.1 106 ATNA 109
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.67310111IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-4411108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MASSSSYSNS PCAACKFLRR KCMPDCIFAP YFPPEEPQKF ANVHKIFGAS NVSKLLNEVL  60
PHQREDAVNS LAYEAEARMK DPVYGCVGAI SVLQRQVIRL QKELDATNAD LMRYACNEMP  120
ADHHSHYAGS RRSNNSNNNS GHGSGGAGSS WGLNSGLYFS SPWNDSQERG TEGNM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879300.11e-130PREDICTED: LOB domain-containing protein 25
RefseqXP_015879301.11e-130PREDICTED: LOB domain-containing protein 25
RefseqXP_015897788.11e-130PREDICTED: LOB domain-containing protein 25-like
RefseqXP_015897789.11e-130PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q33e-71LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A067LNI62e-90A0A067LNI6_JATCU; Uncharacterized protein
STRINGPOPTR_0001s35280.16e-89(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.16e-68LOB domain-containing protein 25